
Pharma Grade 20mg/Kit Sermorelin Acetate Bodybuilding Peptides Loss Weight
Contact Person : Qin
Phone Number : +86 13663845045
WhatsApp : +8613663845045
Minimum Order Quantity : | 10g | Price : | Negotiable |
---|---|---|---|
Delivery Time : | 1-2works day | Payment Terms : | L/C, D/A, D/P, T/T, Western Union, MoneyGram |
Supply Ability : | 100kg/month |
Place of Origin: | China | Brand Name: | Filter |
---|---|---|---|
Model Number: | 16789-98-3 |
Detail Information |
|||
Purity: | >98% | Colour: | White |
---|---|---|---|
Form: | Powder | Cas: | 16789-98-3 |
High Light: | pharmaceutical raw materials,pharma labs steroids |
Product Description
Lab Supply Pharmaceutical Intermediate Powder Peptide Glucagon Hydrochloride 16941-32-5
Product details:
Product Name: | Glucagon |
Synonyms: | GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN |
CAS: | 16941-32-5 |
MF: | C153H225N43O49S |
MW: | 3482.75 |
EINECS: | 232-708-2 |
Product Categories: | Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research |
Purity: | 98%.99% |
Molecular structure |
What is Glucagon Acetate ?
Glucagon is a peptide hormone, produced by alpha cells of the pancreas, that raises the concentration of glucose in the bloodstream. Its effect is opposite that of , which lowers the glucose concentration.The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream. High blood glucose levels stimulate the release of. allows glucose to be taken up and used by -dependent tissues. Thus, glucagon and insulin are part of a feedback system that keeps blood glucose levels at a stable level. Glucagon belongs to a family of several other related hormones.
Brief Introduction :
1. Somatostatin has two active forms produced by alternative cleavage of a single preproprotein: one of 14 amino acids, the other of 28 amino acids.
2. In all vertebrates, there exist six different somatostatin genes that have been named SS1, SS2, SS3, SS4, SS5, and SS6. The six different genes along with the five different somatostatin receptors allows somatostatin to possess a large range of functions. Humans have only one somatostatin gene, SST.
Packaging & Delivery Strategies:
Sufficient stock.
Sophisticated and professional logistic agent.
Well-trained and disciplined packing team. Unique and discreet ways to ship 2 mg/vial to 20mg/vial at one time to your destination. Fast and discreet shipments could be arranged for customs pass Guaranteed.
Packing pictures and tacking code are provided within 12 hours after receiving the payment.
Updated tracking information will be provided every other day.
Excellent after-sale service: Any questions or problems after receiving the product, please feel free to contact us.
Products Customization:
1. 0.5mg CJC with DAC + 0.5mg
2. Hexarelin+1mg ipamorelin
3. Ghrp-6 1mg+Ipamorelin
4. 1mg+Cjc-12951mg+MGf 500mcg
We can mix different polypeptides according to your requirement.
Enter Your Message